PDB entry 5nrv

View 5nrv on RCSB PDB site
Description: Human DNMT3B PWWP domain in complex with 6-dipropylamino-1-hexanol
Class: transferase
Keywords: DNMT3B PWWP DOMAIN, HISTONE BINDING, BETA BARREL, LIGAND, transferase
Deposited on 2017-04-25, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (cytosine-5)-methyltransferase 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dnmt3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nrva_
  • Chain 'D':
    Compound: DNA (cytosine-5)-methyltransferase 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dnmt3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nrvd_
  • Heterogens: 96K, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nrvA (A:)
    eadsgdgdsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfg
    dgkfsevsadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsl
    edqlkpmlewahggfkptgieglkpnntqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nrvA (A:)
    eydgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsadk
    lvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsledqlkpmlewahggfk
    ptgieglkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nrvD (D:)
    eadsgdgdsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfg
    dgkfsevsadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsl
    edqlkpmlewahggfkptgieglkpnntqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nrvD (D:)
    eyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsad
    klvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpdsledqlkpmlewahgg
    fkptgieglkp