PDB entry 5nrr

View 5nrr on RCSB PDB site
Description: Human DNMT3B PWWP domain in complex with 5-[(2-Hydroxyethyl)(propyl)amino]-1-pentanol
Class: transferase
Keywords: DNMT3B PWWP DOMAIN, HISTONE BINDING, BETA BARREL, LIGAND, transferase
Deposited on 2017-04-25, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (cytosine-5)-methyltransferase 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dnmt3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nrra_
  • Chain 'B':
    Compound: DNA (cytosine-5)-methyltransferase 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dnmt3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nrrb_
  • Heterogens: 96E, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nrrA (A:)
    eadsgdgdsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfg
    dgkfsevsadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsl
    edqlkpmlewahggfkptgieglkpnntqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nrrA (A:)
    dsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsev
    sadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpssledqlkpmlewa
    hggfkptgieglkpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nrrB (B:)
    eadsgdgdsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfg
    dgkfsevsadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsl
    edqlkpmlewahggfkptgieglkpnntqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nrrB (B:)
    seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
    dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmle
    wahggfkptgieglkpn