PDB entry 5nrm

View 5nrm on RCSB PDB site
Description: Crystal structure of the sixth cohesin from Acetivibrio cellulolyticus' scaffoldin B in complex with Cel5 dockerin S51I, L52N mutant
Class: cell adhesion
Keywords: cellulosome, cohesin, dockerin, type I cohesin-dockerin, Coh-Doc, protein-protein interaction, cell adhesion
Deposited on 2017-04-24, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: cipV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RPL0 (0-138)
      • expression tag (139-140)
    Domains in SCOPe 2.07: d5nrma1, d5nrma2
  • Chain 'B':
    Compound: DocCel5: Type I dockerin repeat domain from A. cellulolyticus family 5 endoglucanase WP_010249057 S51I, L52N mutant
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: BglC
    Database cross-references and differences (RAF-indexed):
    • PDB 5NRM (0-65)
    Domains in SCOPe 2.07: d5nrmb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nrmA (A:)
    tgfnlsidtvegnpgssvvvpvklsgiskngistadftvtydatkleyisgdagsivtnp
    gvnfginkesdgklkvlfldytmstgyistdgvfanlnfnikssaaigskaevsisgtpt
    fgdstltpvvakvtngavnle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nrmB (B:)
    kpgdvdgngsinsidfalmrnyllgnlkdfpaeddikagdlngdksinindfaimrmyll
    gmitkf