PDB entry 5nrm
View 5nrm on RCSB PDB site
Description: Crystal structure of the sixth cohesin from Acetivibrio cellulolyticus' scaffoldin B in complex with Cel5 dockerin S51I, L52N mutant
Class: cell adhesion
Keywords: cellulosome, cohesin, dockerin, type I cohesin-dockerin, Coh-Doc, protein-protein interaction, cell adhesion
Deposited on
2017-04-24, released
2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated
2018-02-07, with a file datestamp of
2018-02-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: endoglucanase
Species: Acetivibrio cellulolyticus [TaxId:35830]
Gene: cipV
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5nrma1, d5nrma2 - Chain 'B':
Compound: DocCel5: Type I dockerin repeat domain from A. cellulolyticus family 5 endoglucanase WP_010249057 S51I, L52N mutant
Species: Acetivibrio cellulolyticus [TaxId:35830]
Gene: BglC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5nrmb_ - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5nrmA (A:)
tgfnlsidtvegnpgssvvvpvklsgiskngistadftvtydatkleyisgdagsivtnp
gvnfginkesdgklkvlfldytmstgyistdgvfanlnfnikssaaigskaevsisgtpt
fgdstltpvvakvtngavnle
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5nrmB (B:)
kpgdvdgngsinsidfalmrnyllgnlkdfpaeddikagdlngdksinindfaimrmyll
gmitkf