PDB entry 5nrk

View 5nrk on RCSB PDB site
Description: Crystal structure of the sixth cohesin from Acetivibrio cellulolyticus' scaffoldin B in complex with Cel5 dockerin S15I, I16N mutant
Class: protein binding
Keywords: cellulosome, cohesin, dockerin, type I cohesin-dockerin, Coh-Doc, protein-protein interaction, protein binding
Deposited on 2017-04-24, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: cipV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RPL0 (1-140)
      • initiating methionine (0)
      • expression tag (141-142)
    Domains in SCOPe 2.07: d5nrka1, d5nrka2
  • Chain 'B':
    Compound: DocCel5: Type I dockerin repeat domain from A. cellulolyticus family 5 endoglucanase WP_010249057 S15I, I16N mutant
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: BglC
    Database cross-references and differences (RAF-indexed):
    • PDB 5NRK (0-67)
    Domains in SCOPe 2.07: d5nrkb_
  • Chain 'C':
    Compound: endoglucanase
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: cipV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RPL0 (1-140)
      • initiating methionine (0)
      • expression tag (141-142)
    Domains in SCOPe 2.07: d5nrkc1, d5nrkc2
  • Chain 'D':
    Compound: DocCel5: Type I dockerin repeat domain from A. cellulolyticus family 5 endoglucanase WP_010249057 S15I, I16N mutant
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: BglC
    Database cross-references and differences (RAF-indexed):
    • PDB 5NRK (0-End)
    Domains in SCOPe 2.07: d5nrkd_
  • Heterogens: CA, SCN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nrkA (A:)
    mqtgfnlsidtvegnpgssvvvpvklsgiskngistadftvtydatkleyisgdagsivt
    npgvnfginkesdgklkvlfldytmstgyistdgvfanlnfnikssaaigskaevsisgt
    ptfgdstltpvvakvtngavnle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nrkB (B:)
    kpgdvdgngsinindfalmrnyllgnlkdfpaeddikagdlngdksinsldfaimrmyll
    gmitkfsv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nrkC (C:)
    mqtgfnlsidtvegnpgssvvvpvklsgiskngistadftvtydatkleyisgdagsivt
    npgvnfginkesdgklkvlfldytmstgyistdgvfanlnfnikssaaigskaevsisgt
    ptfgdstltpvvakvtngavnle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nrkD (D:)
    kpgdvdgngsinindfalmrnyllgnlkdfpaeddikagdlngdksinsldfaimrmyll
    gmitkfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nrkD (D:)
    kpgdvdgngsinindfalmrnyllgnlkdfpaeddikagdlngdksinsldfaimrmyll
    gmitkfs