PDB entry 5nr7

View 5nr7 on RCSB PDB site
Description: Mtb TMK crystal structure in complex with compound 43
Class: transferase
Keywords: Thymidylate kinase, Nucleotide Binding, inhibitor, Transferase
Deposited on 2017-04-22, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: tmk, Rv3247c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nr7a_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: tmk, Rv3247c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nr7b_
  • Heterogens: YUI, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nr7A (A:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatlappdvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nr7A (A:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelrdaelqqrtgavyaelaaqgwggrwlvvgadvdpg
    rlaatlap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nr7B (B:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatlappdvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nr7B (B:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsrdaelqqrtgavyaelaaqgwggrwlvvgadvdpgrla
    atla