PDB entry 5nr2

View 5nr2 on RCSB PDB site
Description: Crystal structure of the ferric enterobactin receptor (PfeA) from Pseudomonas aeruginosa in complex with azotochelin
Class: membrane protein
Keywords: PfeA, PA2688, outer membrane receptor, azotochelin, membrane protein
Deposited on 2017-04-21, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric enterobactin receptor
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: pfeA, PA2688
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nr2a_
  • Heterogens: FE, 95B, EDO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nr2A (A:)
    gamagqgdgsvielgeqtvvataqeetkqapgvsiitaediakrppsndlsqiirtmpgv
    nltgnsssgqrgnnrqidirgmgpentlilvdgkpvssrnsvrygwrgerdsrgdtnwvp
    adqverievirgpaaarygngaaggvvniitkqagaethgnlsvysnfpqhkaegaserm
    sfglngpltenlsyrvygniaktdsddwdinaghesnrtgkqagtlpagregvrnkdidg
    llswrltpeqtlefeagfsrqgniytgdtqntnsnnyvkqmlghetnrmyretysvthrg
    ewdfgsslaylqyektrnsrineglaggtegifdpnnagfytatlrdltahgevnlplhl
    gyeqtltlgsewteqklddpssntqnteeggsipglagknrsssssarifslfaedniel
    mpgtmltpglrwdhhdivgdnwspslnlshaltervtlkagiaraykapnlyqlnpdyll
    ysrgqgcygqstscylrgndglkaetsvnkelgieyshdglvagltyfrndyknkiesgl
    spvdhasggkgdyanaaiyqwenvpkavveglegtltlpladglkwsnnltymlqsknke
    tgdvlsvtprytlnsmldwqatddlslqatvtwygkqkpkkydyhgdrvtgsandqlspy
    aiaglggtyrlsknlslgagvdnlfdkrlfragnaqgvvgidgagaatynepgrtfytsl
    tasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nr2A (A:)
    kqapgvsiitaediakrppsndlsqiirtmpgvnltgnsssgqrgnnrqidirgmgpent
    lilvdgkpvssrnsvrygwrgerdsrgdtnwvpadqverievirgpaaarygngaaggvv
    niitkqagaethgnlsvysnfpqhkaegasermsfglngpltenlsyrvygniaktdsdd
    wdinaghesnrtgkqagtlpagregvrnkdidgllswrltpeqtlefeagfsrqgniytg
    dtqntnsnnyvkqmlghetnrmyretysvthrgewdfgsslaylqyektrnsrineglag
    gtegifdpnnagfytatlrdltahgevnlplhlgyeqtltlgsewteqklddpssntqnt
    eeggsipglagknrsssssarifslfaednielmpgtmltpglrwdhhdivgdnwspsln
    lshaltervtlkagiaraykapnlyqlnpdyllysrgqgcygqstscylrgndglkaets
    vnkelgieyshdglvagltyfrndyknkiesglspvdhasggkgdyanaaiyqwenvpka
    vveglegtltlpladglkwsnnltymlqsknketgdvlsvtprytlnsmldwqatddlsl
    qatvtwygkqkpkkydyhgdrvtgsandqlspyaiaglggtyrlsknlslgagvdnlfdk
    rlfragnaqgvvgidgagaatynepgrtfytsltasf