PDB entry 5nqb

View 5nqb on RCSB PDB site
Description: Rabbit Muscle L-lactate dehydrogenase in complex with malonate
Class: oxidoreductase
Keywords: malonate, oxidoreductase
Deposited on 2017-04-19, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13491 (Start-331)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d5nqba1, d5nqba2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13491 (Start-331)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d5nqbb1, d5nqbb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13491 (Start-331)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d5nqbc1, d5nqbc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13491 (Start-331)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d5nqbd1, d5nqbd2
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nqbA (A:)
    maalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkg
    emmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    halschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsaye
    viklkgytswaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngi
    sdvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nqbA (A:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nqbB (B:)
    maalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkg
    emmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    halschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsaye
    viklkgytswaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngi
    sdvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nqbB (B:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nqbC (C:)
    maalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkg
    emmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    halschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsaye
    viklkgytswaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngi
    sdvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nqbC (C:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nqbD (D:)
    maalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkg
    emmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    halschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsaye
    viklkgytswaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngi
    sdvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nqbD (D:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf