PDB entry 5nq6

View 5nq6 on RCSB PDB site
Description: Crystal structure of the inhibited form of the redox-sensitive SufE-like sulfur acceptor CsdE from Escherichia coli at 2.40 Angstrom Resolution
Class: sulfur-acceptor protein
Keywords: sulfur-binding protein, sulfur-acceptor protein, l-cysteine desulfurase, transpersulfuration, sulfur trafficking
Deposited on 2017-04-19, released 2018-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Gene: csdE, ygdK, b2811, JW2782
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nq6a_
  • Chain 'B':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Gene: csdE, ygdK, b2811, JW2782
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGF2 (Start-146)
      • expression tag (147-148)
    Domains in SCOPe 2.08: d5nq6b1, d5nq6b2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nq6A (A:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nq6A (A:)
    aghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvw
    lgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqls
    asrsqglnalseaiiaatkqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nq6B (B:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nq6B (B:)
    ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwl
    gytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsa
    srsqglnalseaiiaatkqvkh