PDB entry 5npq

View 5npq on RCSB PDB site
Description: Human N-myristoyltransferase 1 (MNT1) with Myristoyl-CoA analogue X10 bound
Class: transferase
Keywords: N-myristoylation, transferase, Myristol-CoA analogue, UV active, chemical probe
Deposited on 2017-04-18, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5npqa1, d5npqa2
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5npqb1, d5npqb2
  • Heterogens: GOL, 94Q, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5npqA (A:)
    gphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgd
    rgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgf
    isaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagv
    vlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkd
    ipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlps
    timnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktflekl
    kfgigdgnlqyylynwkcpsmgaekvglvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5npqA (A:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihiydtekk
    mveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcrywhrsl
    nprklimqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkqfhltpvmsqeeveh
    wfypqeniidtfvvenangevtdflsfytlpstslkaaysfynvhtqtplldlmsdalvl
    akmkgfdvfnaldlmenktfleklkfgigdgnlqyylynwkcpsmgaekvglvlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5npqB (B:)
    gphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgd
    rgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgf
    isaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagv
    vlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkd
    ipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlps
    timnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktflekl
    kfgigdgnlqyylynwkcpsmgaekvglvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5npqB (B:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
    iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
    rywhrslnprklievkftmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkqfh
    ltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthkslkaays
    fynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylynw
    kcpsmgaekvglvlq