PDB entry 5npn

View 5npn on RCSB PDB site
Description: Refined structure of cytotoxin I
Class: toxin
Keywords: toxin, cobra venom, cytolytic peptide, thre-finger folded protein
Deposited on 2017-04-17, released 2018-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxin 1
    Species: Naja oxiana [TaxId:8657]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5npna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5npnA (A:)
    lkcnklvpiayktcpegknlcykmfmmsdltipvkrgcidvcpknsllvkyvccntdrcn