PDB entry 5npa

View 5npa on RCSB PDB site
Description: Solution structure of Drosophila melanogaster Loquacious dsRBD2
Class: RNA binding protein
Keywords: dsRBD, RNA interference, siRNA, RNA binding protein
Deposited on 2017-04-16, released 2017-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Loquacious
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: loqs, DmelCG6866, dRax, loq, LOQS, Loqs, R3D1, r3d1, R3D1-L, R3D1-S, TRBP, CG6866, Dmel_CG6866
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5npaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5npaA (A:)
dktvgigwlqemcmqrrwpppsyetetevglpherlftiacsilnyremgkgkskkiakr
laahrmwmrlqe

    Sequence, based on observed residues (ATOM records): (download) 
    >5npaA (A:)
igwlqemcmqrrwpppsyetetevglpherlftiacsilnyremgkgkskkiakrlaahr
mwmrlqe