PDB entry 5np8

View 5np8 on RCSB PDB site
Description: PGK1 in complex with CRT0063465 (3-[2-(4-bromophenyl)-5,7-dimethyl-pyrazolo[1,5-a]pyrimidin-6-yl]propanoic acid)
Class: transferase
Keywords: Kinase, transferase
Deposited on 2017-04-13, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGK1, PGKA, MIG10, OK/SW-cl.110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5np8a_
  • Heterogens: 93T, EDO, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5np8A (A:)
    gshmslsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaks
    vvlmshlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvi
    llenlrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmv
    gvnlpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiig
    ggmaftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenak
    tgqatvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmd
    evvkatsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni
    

    Sequence, based on observed residues (ATOM records): (download)
    >5np8A (A:)
    nkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlmshl
    grpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenlrf
    hveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlpqk
    aggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaftf
    lkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatva
    sgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkats
    rgcitiigkwntedkvshvstgggaslellegkvlpgvdalsni