PDB entry 5np5

View 5np5 on RCSB PDB site
Description: Abl2 SH3 pTyr116/161
Class: transferase
Keywords: signaling, tyrosine phosphorylation, SH3 domain, kinase, Transferase
Deposited on 2017-04-13, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abelson tyrosine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42684 (4-60)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5np5a1, d5np5a2
  • Chain 'B':
    Compound: Abelson tyrosine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5np5b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5np5A (A:)
    gshmnlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpv
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5np5B (B:)
    gshmnlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpv
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >5np5B (B:)
    nlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpvn