PDB entry 5np3

View 5np3 on RCSB PDB site
Description: Abl2 SH3
Class: transferase
Keywords: signaling, tyrosine phosphorylation, SH3 domain, kinase, Transferase
Deposited on 2017-04-13, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abelson tyrosine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5np3a_
  • Chain 'B':
    Compound: Abelson tyrosine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42684 (4-60)
      • expression tag (3)
    Domains in SCOPe 2.07: d5np3b1, d5np3b2
  • Chain 'C':
    Compound: Abelson tyrosine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5np3c_
  • Chain 'D':
    Compound: Abelson tyrosine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42684 (4-60)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d5np3d1, d5np3d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5np3A (A:)
    gshmnlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpv
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >5np3A (A:)
    nlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5np3B (B:)
    gshmnlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpv
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >5np3B (B:)
    mnlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5np3C (C:)
    gshmnlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpv
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >5np3C (C:)
    nlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5np3D (D:)
    gshmnlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpv
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >5np3D (D:)
    shmnlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpvn