PDB entry 5nmv

View 5nmv on RCSB PDB site
Description: Crystal structure of 2F22 Fab fragment against TFPI1
Class: immune system
Keywords: Fab, immune system
Deposited on 2017-04-07, released 2018-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus [TaxId:10088]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NMV (0-End)
  • Chain 'K':
    Compound: tissue factor pathway inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: TFPI, LACI, TFPI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nmvk_
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus [TaxId:10088]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NMV (0-End)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5nmvK (K:)
    gssgssgdseedeehtiitdtelpplklmhsfcafkaddgpckaimkrfffniftrqcee
    fiyggcegnqnrfesleeckkmctrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmvK (K:)
    elpplklmhsfcafkaddgpckaimkrfffniftrqceefiyggcegnqnrfesleeckk
    mct
    

  • Chain 'L':
    No sequence available.