PDB entry 5nm6

View 5nm6 on RCSB PDB site
Description: Chicken GRIFIN (crystallisation pH: 4.6)
Class: sugar binding protein
Keywords: Galectin related protein, sugar binding protein
Deposited on 2017-04-05, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nm6a_
  • Chain 'B':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nm6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nm6A (A:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm6A (A:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkrgly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nm6B (B:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm6B (B:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkrgl