PDB entry 5nm1

View 5nm1 on RCSB PDB site
Description: Chicken GRIFIN (crystallisation pH: 6.2)
Class: sugar binding protein
Keywords: Galectin related protein, sugar binding protein
Deposited on 2017-04-05, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nm1a_
  • Chain 'B':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nm1b_
  • Chain 'C':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nm1c_
  • Chain 'D':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nm1d_
  • Heterogens: LBT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nm1A (A:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm1A (A:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nm1B (B:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm1B (B:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nm1C (C:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm1C (C:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkrgly
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nm1D (D:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm1D (D:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkr