PDB entry 5nle

View 5nle on RCSB PDB site
Description: Chicken GRIFIN (crystallisation pH: 8.0)
Class: sugar binding protein
Keywords: Galectin related protein, sugar binding protein
Deposited on 2017-04-04, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nlea_
  • Chain 'B':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nleb_
  • Chain 'C':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nlec_
  • Chain 'D':
    Compound: galectin
    Species: Gallus gallus [TaxId:9031]
    Gene: GRIFIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nled_
  • Heterogens: LBT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nleA (A:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nleA (A:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nleB (B:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nleB (B:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nleC (C:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nleC (C:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkrgly
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nleD (D:)
    malrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcn
    sflanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitkl
    qilndieissveitkrgly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nleD (D:)
    alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
    flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
    ilndieissveitkrgly