PDB entry 5nkt

View 5nkt on RCSB PDB site
Description: FimA wt from E. coli
Class: structural protein
Keywords: FimA, pilus, monomer, subunit, pili, Escherichia, coli, pathogenic, main structural subunit, high resolution, STRUCTURAL PROTEIN
Deposited on 2017-04-03, released 2018-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type-1 fimbrial protein, A chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: fimA, pilA, b4314, JW4277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nkta_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nktA (A:)
    aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
    cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
    ettlnngtntipfqaryfatgaatpgaanadatfkvqyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nktA (A:)
    ggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlndcdtnva
    skaavaflgtaidaghtnvlalqssgsatnvgvqildrtgaaltldgatfssettlnngt
    ntipfqaryfatgaatpgaanadatfkvqyq