PDB entry 5nkq

View 5nkq on RCSB PDB site
Description: Crystal structure of a dual topology fluoride ion channel.
Class: transport protein
Keywords: Dual topology channel, Fluoride channel, monobody, transport protein
Deposited on 2017-03-31, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative fluoride ion transporter crcb
    Species: Bordetella pertussis [TaxId:520]
    Gene: crcB, BP1217
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VYU0 (Start-127)
      • conflict (28)
      • conflict (93)
  • Chain 'B':
    Compound: putative fluoride ion transporter crcb
    Species: Bordetella pertussis [TaxId:520]
    Gene: crcB, BP1217
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VYU0 (Start-127)
      • conflict (28)
      • conflict (93)
  • Chain 'C':
    Compound: putative fluoride ion transporter crcb
    Species: Bordetella pertussis [TaxId:520]
    Gene: crcB, BP1217
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VYU0 (Start-127)
      • conflict (28)
      • conflict (93)
  • Chain 'D':
    Compound: putative fluoride ion transporter crcb
    Species: Bordetella pertussis [TaxId:520]
    Gene: crcB, BP1217
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VYU0 (Start-127)
      • conflict (28)
      • conflict (93)
  • Chain 'E':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NKQ (Start-91)
    Domains in SCOPe 2.07: d5nkqe_
  • Chain 'F':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NKQ (Start-91)
    Domains in SCOPe 2.07: d5nkqf_
  • Chain 'G':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NKQ (0-91)
    Domains in SCOPe 2.07: d5nkqg_
  • Chain 'H':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NKQ (0-91)
    Domains in SCOPe 2.07: d5nkqh_
  • Heterogens: NA, F, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5nkqE (E:)
    svssvptklevvaatptslliswdayydevmyyritygetggnspvqeftvpgssstati
    sglkpgvdytitvyayydsyghwspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nkqE (E:)
    ssvptklevvaatptslliswdayydevmyyritygetspvqeftvpgssstatisglkp
    gvdytitvyayydsyghwspisinyrt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nkqF (F:)
    svssvptklevvaatptslliswdayydevmyyritygetggnspvqeftvpgssstati
    sglkpgvdytitvyayydsyghwspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nkqF (F:)
    ssvptklevvaatptslliswdayydevmyyritygetpvqeftvpgssstatisglkpg
    vdytitvyayydsyghwspisinyrt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5nkqG (G:)
    svssvptklevvaatptslliswdayydevmyyritygetggnspvqeftvpgssstati
    sglkpgvdytitvyayydsyghwspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nkqG (G:)
    svssvptklevvaatptslliswdayydevmyyritygetpvqeftvpgssstatisglk
    pgvdytitvyayydsyghwspisinyrt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5nkqH (H:)
    svssvptklevvaatptslliswdayydevmyyritygetggnspvqeftvpgssstati
    sglkpgvdytitvyayydsyghwspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nkqH (H:)
    svssvptklevvaatptslliswdayydevmyyritygetvqeftvpgssstatisglkp
    gvdytitvyayydsyghwspisinyrt