PDB entry 5nkn

View 5nkn on RCSB PDB site
Description: Crystal structure of an Anticalin-colchicine complex
Class: transport protein
Keywords: beta-barrel, colchicine, Lcn2, lipocalin, NGAL, protein engineering, transport protein
Deposited on 2017-03-31, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188 (0-End)
      • engineered mutation (23)
      • engineered mutation (31)
      • engineered mutation (35-36)
      • engineered mutation (44)
      • engineered mutation (47)
      • engineered mutation (63-65)
      • engineered mutation (67-68)
      • engineered mutation (72)
      • engineered mutation (74-76)
      • engineered mutation (78)
      • engineered mutation (82)
      • engineered mutation (95)
      • engineered mutation (98)
      • engineered mutation (101)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (127)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5nkna_
  • Heterogens: LOC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nknA (A:)
    sdlipapplskvplqqnfqdnqfhgkwyvvgvagngflredkdpikmaatiyelkedksy
    nvtfqkfpmkkcqymtdtlvpgsqpgeftlgniksepgytswlvrvvstnynqhamvffk
    avqqnredffitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nknA (A:)
    sdlipapplskvplqqnfqdnqfhgkwyvvgvagngflredkdpikmaatiyelkedksy
    nvtfqkfpmkkcqymtdtlvpgsqpgeftlgniksepgytswlvrvvstnynqhamvffk
    avqqnredffitlygrtkeltselkenfirfskslglpenhivfpvpidqci