PDB entry 5njj

View 5njj on RCSB PDB site
Description: PTB domain of human Numb isoform-1
Class: endocytosis
Keywords: PTB domain, Numb, breast cancer, endocytosis
Deposited on 2017-03-29, released 2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein numb homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5njja_
  • Chain 'B':
    Compound: Protein numb homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein numb homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5njjc_
  • Chain 'D':
    Compound: Protein numb homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5njjd_
  • Chain 'E':
    Compound: ala-tyr-ile-gly-pro-ptr-leu
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NJJ (0-6)
  • Chain 'F':
    Compound: ala-tyr-ile-gly-pro-ptr-leu
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NJJ (0-6)
  • Chain 'G':
    Compound: ala-tyr-ile-gly-pro-ptr-leu
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NJJ (0-6)
  • Chain 'H':
    Compound: ala-tyr-ile-gly-pro-ptr-leu
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NJJ (0-6)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5njjA (A:)
    srphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgkt
    gkkavkavlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrw
    ichcfmavkdtgerlshavgcafaaclerkqkreke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5njjA (A:)
    tdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgktgkkavka
    vlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfma
    vkdtgerlshavgcafaaclerk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5njjC (C:)
    srphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgkt
    gkkavkavlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrw
    ichcfmavkdtgerlshavgcafaaclerkqkreke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5njjC (C:)
    deegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgktgkkavkav
    lwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmav
    kdtgerlshavgcafaacler
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5njjD (D:)
    srphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgkt
    gkkavkavlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrw
    ichcfmavkdtgerlshavgcafaaclerkqkreke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5njjD (D:)
    deegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgktgkkavkav
    lwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmav
    kdtgerlshavgcafaaclerkq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.