PDB entry 5niy

View 5niy on RCSB PDB site
Description: Signal recognition particle-docking protein FtsY
Class: signaling protein
Keywords: SRP, GTPase, nucleotide, receptor, SIGNALING PROTEIN
Deposited on 2017-03-27, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle-docking protein FtsY
    Species: Escherichia coli [TaxId:562]
    Gene: BK350_09725, BK355_12030, BK400_00245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5niya1, d5niya2
  • Heterogens: GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5niyA (A:)
    mfarlkrsllktkenlgsgfislfrgkkidddlfeeleeqlliadvgvettrkiitnlte
    gasrkqlrdaealygllkeemgeilakvdeplnvegkapfvilmvgvngvgktttigkla
    rqfeqqgksvmlaagdtfraaaveqlqvwgqrnnipviaqhtgadsasvifdaiqaakar
    nidvliadtagrlqnkshlmeelkkivrvmkkldveaphevmltidastgqnavsqaklf
    heavgltgitltkldgtakggvifsvadqfgipiryigvgeriedlrpfkaddfiealfa
    redhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5niyA (A:)
    arlkrsllktkenlgsgfislfrgkkidddlfeeleeqlliadvgvettrkiitnltega
    srkqlrdaealygllkeemgeilakvdeplnvegkapfvilmvgvngvgktttigklarq
    feqqgksvmlaagdtfraaaveqlqvwgqrnnipviaqhtgadsasvifdaiqaakarni
    dvliadtagrlqnkshlmeelkkivrvmkkldveaphevmltidastgqnavsqaklfhe
    avgltgitltkldgtakggvifsvadqfgipiryigvgeriedlrpfkaddfiealfare