PDB entry 5ni3

View 5ni3 on RCSB PDB site
Description: sfGFP 204-204 mutant dimer
Class: fluorescent protein
Keywords: GFP, super folder, click chemistry, SPAAC, artificial dimers, fluorescent protein
Deposited on 2017-03-23, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (0-226)
      • conflict (27)
      • chromophore (63)
      • conflict (69)
      • conflict (77)
      • engineered mutation (201)
      • conflict (203)
    Domains in SCOPe 2.07: d5ni3a_
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (0-230)
      • conflict (27)
      • chromophore (63)
      • conflict (69)
      • conflict (77)
      • engineered mutation (201)
      • conflict (203)
    Domains in SCOPe 2.07: d5ni3b_
  • Chain 'C':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (0-230)
      • conflict (27)
      • chromophore (63)
      • conflict (69)
      • conflict (77)
      • conflict (201)
      • conflict (203)
    Domains in SCOPe 2.07: d5ni3c_
  • Chain 'D':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (0-End)
      • conflict (27)
      • chromophore (63)
      • conflict (69)
      • conflict (77)
      • conflict (201)
      • conflict (203)
    Domains in SCOPe 2.07: d5ni3d_
  • Heterogens: NA, DB5, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ni3A (A:)
    kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
    tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhy
    qqntpigdgpvllpdnhylstfsvlskdpnekrdhmvllefvtaagi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ni3B (B:)
    kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
    tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhy
    qqntpigdgpvllpdnhylstfsvlskdpnekrdhmvllefvtaagithgm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ni3C (C:)
    kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
    tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhy
    qqntpigdgpvllpdnhylstksvlskdpnekrdhmvllefvtaagithgm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ni3D (D:)
    kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
    tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhy
    qqntpigdgpvllpdnhylstksvlskdpnekrdhmvllefvtaagithgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ni3D (D:)
    kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
    tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhy
    qqntpigdgpvllpdnhylstksvlskdpnekrdhmvllefvtaagi