PDB entry 5nhb

View 5nhb on RCSB PDB site
Description: Crystal structure of xylose isomerase from Piromyces E2 in complex with two Fe2+ ions
Class: isomerase
Keywords: isomerase, TIM-barrel
Deposited on 2017-03-21, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Piromyces sp. E2 [TaxId:73868]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nhba_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Piromyces sp. E2 [TaxId:73868]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nhbb_
  • Chain 'C':
    Compound: xylose isomerase
    Species: Piromyces sp. E2 [TaxId:73868]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nhbc_
  • Chain 'D':
    Compound: xylose isomerase
    Species: Piromyces sp. E2 [TaxId:73868]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nhbd_
  • Heterogens: FE2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nhbA (A:)
    makeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadq
    fgggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnl
    kavvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagie
    lgaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmept
    khqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanr
    gdyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsg
    mdamaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepk
    qtsgkqelyeaivamyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nhbA (A:)
    akeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqf
    gggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlk
    avvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagiel
    gaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptk
    hqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrg
    dyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgm
    damaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkq
    tsgkqelyeaivamyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nhbB (B:)
    makeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadq
    fgggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnl
    kavvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagie
    lgaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmept
    khqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanr
    gdyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsg
    mdamaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepk
    qtsgkqelyeaivamyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nhbB (B:)
    akeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqf
    gggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlk
    avvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagiel
    gaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptk
    hqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrg
    dyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgm
    damaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkq
    tsgkqelyeaivamyq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nhbC (C:)
    makeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadq
    fgggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnl
    kavvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagie
    lgaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmept
    khqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanr
    gdyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsg
    mdamaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepk
    qtsgkqelyeaivamyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nhbC (C:)
    keyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqfg
    ggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlka
    vvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagielg
    aenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptkh
    qydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrgd
    yqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgmd
    amaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkqt
    sgkqelyeaivamyq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nhbD (D:)
    makeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadq
    fgggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnl
    kavvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagie
    lgaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmept
    khqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanr
    gdyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsg
    mdamaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepk
    qtsgkqelyeaivamyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nhbD (D:)
    keyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqfg
    ggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlka
    vvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagielg
    aenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptkh
    qydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrgd
    yqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgmd
    amaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkqt
    sgkqelyeaivamyq