PDB entry 5ngx

View 5ngx on RCSB PDB site
Description: The 1.06 A resolution structure of the L16G mutant of ferric cytochrome c prime from Alcaligenes xylosoxidans, complexed with nitrite
Class: oxidoreductase
Keywords: nitrite, cytochrome, homodimer, oxidoreductase, ferric, heme
Deposited on 2017-03-20, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c'
    Species: ALCALIGENES XYLOSOXYDANS XYLOSOXYDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00138 (0-125)
      • conflict (15)
    Domains in SCOPe 2.07: d5ngxa_
  • Heterogens: HEC, NO2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ngxA (A:)
    efakpedavkyrqsagtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dayrkk