PDB entry 5ngg

View 5ngg on RCSB PDB site
Description: Crystal structure of the subclass B3 metallo-beta-lactamase BJP-1 in complex with acetate anion
Class: hydrolase
Keywords: HYDROLASE, metallo-beta-lactamase, B3 acetate, BJP-1
Deposited on 2017-03-17, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blr6230 protein
    Species: Bradyrhizobium diazoefficiens USDA 110 [TaxId:224911]
    Gene: blr6230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ngga_
  • Chain 'B':
    Compound: Blr6230 protein
    Species: Bradyrhizobium diazoefficiens USDA 110 [TaxId:224911]
    Gene: blr6230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nggb_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nggA (A:)
    mrrltaalcaltllstgaqaqtikdflavamkkwtapfepfqlidniyyvgtdgiavyvi
    ktsqglilmdtampqstgmikdniaklgfkvadiklilnthahldhtggfaeikketgaq
    lvagerdkplleggyypgdeknedlafpavkvdravkegdrvtlgdttltahatpghspg
    ctswemtvkdgkedrevlffcsgtvalnrlvgqptyagivddyratfakakamkidvllg
    phpevygmqakraemkdgapnpfikpgelvtyatslsedfdkqlakqtaalekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nggA (A:)
    qtikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmi
    kdniaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgde
    knedlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlff
    csgtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgap
    npfikpgelvtyatslsedfdkqlakqtaalekk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nggB (B:)
    mrrltaalcaltllstgaqaqtikdflavamkkwtapfepfqlidniyyvgtdgiavyvi
    ktsqglilmdtampqstgmikdniaklgfkvadiklilnthahldhtggfaeikketgaq
    lvagerdkplleggyypgdeknedlafpavkvdravkegdrvtlgdttltahatpghspg
    ctswemtvkdgkedrevlffcsgtvalnrlvgqptyagivddyratfakakamkidvllg
    phpevygmqakraemkdgapnpfikpgelvtyatslsedfdkqlakqtaalekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nggB (B:)
    qtikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmi
    kdniaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgde
    knedlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlff
    csgtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgap
    npfikpgelvtyatslsedfdkqlakqtaalekk