PDB entry 5nfs

View 5nfs on RCSB PDB site
Description: Structure of coxsackievirus B3 3C protease in complex with the alpha-ketoamide (S)-N-benzyl-3-((S)-2-cinnamamido-3-phenylpropanamido)-2-oxo-4-((S)-2-oxopyrrolidin-3-yl)butanamide (cinnamoyl-phenylalanine-GlnLactam-CO-CO-NH-benzyl)
Class: viral protein
Keywords: Viral protease, enterovirus, alpha-ketoamide, inhibitor, viral protein
Deposited on 2017-03-15, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Coxsackievirus B3 [TaxId:12072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfsa_
  • Heterogens: D03, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nfsA (A:)
    mgpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvlda
    kelvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqv
    teygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyf
    ndeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfsA (A:)
    gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
    elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
    eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn