PDB entry 5nfh

View 5nfh on RCSB PDB site
Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with a quinazolinone inhibitor
Class: ligase
Keywords: synthetase, ligase, methionine, inhibitor, ligase-ligase inhibitor, complex, drug discovery
Deposited on 2017-03-14, released 2017-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:185431]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91
      • conflict (77)
      • engineered mutation (220-222)
      • conflict (267)
      • conflict (271)
    Domains in SCOPe 2.07: d5nfha1, d5nfha2
  • Chain 'B':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:185431]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91 (5-535)
      • conflict (77)
      • engineered mutation (220-222)
      • conflict (267)
      • conflict (271)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d5nfhb1, d5nfhb2, d5nfhb3
  • Heterogens: GOL, DMS, MET, 8W2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nfhA (A:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfhA (A:)
    vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
    kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
    ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
    ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
    ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
    lpkkivahgwwtkdvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlngela
    dtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaiia
    vfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifdm
    lgvpevhrkgienfefgavppgtrlgpavegevlfskrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nfhB (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfhB (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitckvslesghvvtwvseenymfrlsafrerllewy
    hanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltn
    yltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpk
    kivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmia
    rlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipd
    iqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprk
    svvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrst