PDB entry 5nfe

View 5nfe on RCSB PDB site
Description: Neutron structure of human transthyretin (TTR) T119M mutant at room temperature to 1.85A resolution
Class: transport protein
Keywords: transthyretin, prealbumin, homotetramer, transport protein
Deposited on 2017-03-14, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAYNEUT
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • conflict (121)
    Domains in SCOPe 2.07: d5nfea_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • conflict (121)
    Domains in SCOPe 2.07: d5nfeb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nfeA (A:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    tmavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfeA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nfeB (B:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    tmavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfeB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtnp