PDB entry 5ndu

View 5ndu on RCSB PDB site
Description: ENAH EVH1 in complex with Ac-[2-Cl-F]-[ProM-2]-[ProM-12]-OMe
Class: cell adhesion
Keywords: proline-rich motif, Ena/VASP inhibitor, actin, protein-protein interaction, cell adhesion
Deposited on 2017-03-09, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: ENAH, MENA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ndua_
  • Chain 'B':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: ENAH, MENA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N8S7 (2-112)
      • expression tag (1)
    Domains in SCOPe 2.07: d5ndub1, d5ndub2
  • Heterogens: 8V2, SO4, NO3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nduA (A:)
    gsmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqv
    vincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nduA (A:)
    eqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvinc
    aipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nduB (B:)
    gsmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqv
    vincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nduB (B:)
    smseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl