PDB entry 5ncv

View 5ncv on RCSB PDB site
Description: Crystal Structure of Cytochrome c in complex with p-Methylphosphonatocalix[4]arene
Class: oxidoreductase
Keywords: methylphosphonatocalix[4]arene, cytochrome c, lysine recognition, protein assembly, oxidoreductase
Deposited on 2017-03-06, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-107)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5ncva_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-107)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5ncvb_
  • Heterogens: HEC, 8TE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ncvA (A:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ncvA (A:)
    agsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlw
    dennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ncvB (B:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ncvB (B:)
    agsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlw
    dennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate