PDB entry 5ncp

View 5ncp on RCSB PDB site
Description: ENAH EVH1 in complex with Ac-[2-Cl-F]-[ProM-2]-[ProM-12]-OH
Class: cell adhesion
Keywords: proline-rich motif, Ena/VASP inhibitor, actin, protein-protein interaction, cell adhesion
Deposited on 2017-03-06, released 2018-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-25, with a file datestamp of 2020-11-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: ENAH, MENA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ncpa_
  • Heterogens: EG5, NO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5ncpA (A:)
gsmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqv
vincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

    Sequence, based on observed residues (ATOM records): (download) 
    >5ncpA (A:)
eqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvinc
aipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl