PDB entry 5ncm

View 5ncm on RCSB PDB site
Description: Crystal structure Cbk1(NTR)-Mob2 complex
Class: signaling protein
Keywords: SIGNALING protein, kinase
Deposited on 2017-03-06, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CBK1 kinase activator protein MOB2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MOB2, YFL034C-B, YFL035C, YFL035C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43563
      • engineered mutation (105)
    Domains in SCOPe 2.07: d5ncma_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase CBK1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CBK1, YNL161W, N1727
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ncmA (A:)
    gslrnkhhspkrhsqtsfpaqkstpqsqqltsttpqsqqqeasersesqqimflsepfvr
    talvkgsfktivqlpkyvdlgewialnvfefftnlnqfygvvaeyctpdacptmnagpht
    dylwldannrqvslpasqyidlaltwinnkvndknlfptknglpfpqqfsrdvqrimvqm
    frifahiyhhhfdkivhlsleahwnsffshfisfakefkiidrkemapllpliesfekqg
    kiiyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ncmA (A:)
    qimflsepfvrtalvkgsfktivqlpkyvdlgewialnvfefftnlnqfygvvaeyctpd
    nagphtdylwldanlpasqyidlaltwinnkvndknlfptknglpfpqqfsrdvqrimvq
    mfrifahiyhhhfdkivhlsleahwnsffshfisfakefkiidrkemapllpliesfekq
    gki
    

  • Chain 'B':
    No sequence available.