PDB entry 5ncb

View 5ncb on RCSB PDB site
Description: Crystal structure of Amycolatopsis cytochrome P450 GcoA in complex with guaiacol.
Class: oxidoreductase
Keywords: Cytochrome, P450, guaiacol, lignin, CYP255A, Amycolatopsis, heme, haem, oxidoreductase
Deposited on 2017-03-03, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Amycolatopsis sp. ATCC 39116 [TaxId:385957]
    Gene: WP_020419855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ncba_
  • Heterogens: HEM, JZ3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ncbA (A:)
    gpmttterpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcreva
    tspdfeavitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarr
    ylerfendghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsftnaavdeng
    efanpegfaegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiypt
    iyvyllgamqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsatar
    istkpvtiagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacag
    iyfanhvmrialeelfeaipnlerdtregvefwgwgfrgptslhvtwev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ncbA (A:)
    erpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcrevatspdfe
    avitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarrylerfe
    ndghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsftnaavdengefanpe
    gfaegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiyptiyvyll
    gamqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsataristkpv
    tiagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacagiyfanh
    vmrialeelfeaipnlerdtregvefwgwgfrgptslhvtwev