PDB entry 5nc4

View 5nc4 on RCSB PDB site
Description: Crystal structure of the ferric enterobactin receptor (PfeA) in complex with protochelin from Pseudomonas aeruginosa
Class: membrane protein
Keywords: PfeA, PA2688, outer membrane receptor, membrane protein, protochelin
Deposited on 2017-03-03, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric enterobactin receptor
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: pfeA, PA2688
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nc4a_
  • Heterogens: FE, 8T2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nc4A (A:)
    gamagqgdgsvielgeqtvvataqeetkqapgvsiitaediakrppsndlsqiirtmpgv
    nltgnsssgqrgnnrqidirgmgpentlilvdgkpvssrnsvrygwrgerdsrgdtnwvp
    adqverievirgpaaarygngaaggvvniitkqagaethgnlsvysnfpqhkaegaserm
    sfglngpltenlsyrvygniaktdsddwdinaghesnrtgkqagtlpagregvrnkdidg
    llswrltpeqtlefeagfsrqgniytgdtqntnsnnyvkqmlghetnrmyretysvthrg
    ewdfgsslaylqyektrnsrineglaggtegifdpnnagfytatlrdltahgevnlplhl
    gyeqtltlgsewteqklddpssntqnteeggsipglagknrsssssarifslfaedniel
    mpgtmltpglrwdhhdivgdnwspslnlshaltervtlkagiaraykapnlyqlnpdyll
    ysrgqgcygqstscylrgndglkaetsvnkelgieyshdglvagltyfrndyknkiesgl
    spvdhasggkgdyanaaiyqwenvpkavveglegtltlpladglkwsnnltymlqsknke
    tgdvlsvtprytlnsmldwqatddlslqatvtwygkqkpkkydyhgdrvtgsandqlspy
    aiaglggtyrlsknlslgagvdnlfdkrlfragnaqgvvgidgagaatynepgrtfytsl
    tasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nc4A (A:)
    kqapgvsiitaediakrppsndlsqiirtmpgvnltgnsssgqrgnnrqidirgmgpent
    lilvdgkpvssrnsvrygwrgerdsrgdtnwvpadqverievirgpaaarygngaaggvv
    niitkqagaethgnlsvysnfpqhkaegasermsfglngpltenlsyrvygniaktdsdd
    wdinaghesnrtgkqagtlpagregvrnkdidgllswrltpeqtlefeagfsrqgniytg
    dtqntnsnnyvkqmlghetnrmyretysvthrgewdfgsslaylqyektrnsrineglag
    gtegifdpnnagfytatlrdltahgevnlplhlgyeqtltlgsewteqklddpssntqnt
    eeggsipglagknrsssssarifslfaednielmpgtmltpglrwdhhdivgdnwspsln
    lshaltervtlkagiaraykapnlyqlnpdyllysrgqgcygqstscylrgndglkaets
    vnkelgieyshdglvagltyfrndyknkiesglspvdhasggkgdyanaaiyqwenvpka
    vveglegtltlpladglkwsnnltymlqsknketgdvlsvtprytlnsmldwqatddlsl
    qatvtwygkqkpkkydyhgdrvtgsandqlspyaiaglggtyrlsknlslgagvdnlfdk
    rlfragnaqgvvgidgagaatynepgrtfytsltasf