PDB entry 5nbo

View 5nbo on RCSB PDB site
Description: Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16
Class: hydrolase
Keywords: Glycoside hydrolase, GH16, hydrolase
Deposited on 2017-03-02, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl hydrolase family 16
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: BACOVA_02741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nboa_
  • Chain 'B':
    Compound: Glycosyl hydrolase family 16
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: BACOVA_02741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nbob_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nboA (A:)
    mgsshhhhhhssglvprgshmsdsvgtepeenpqdilfkddfnffdekvwtkethepgwt
    nqelqaydaahvsvgkdgdksvliltaerkgnkiysgrinskgkksfkyrkieasiklpk
    tngglwpafwmmgdndkqwpacgeidimemgeqsgmaagdsekqvntaihygpsaaaheq
    qyykanvanslqdgnyhtysldwdennltisidnvkfhtfdissntyfhdnfyilfnlav
    ggaftgitdinkltglkdgqkvnmyidwvkil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nboA (A:)
    ilfkddfnffdekvwtkethepgwtnqelqaydaahvsvgkdgdksvliltaerkgnkiy
    sgrinskgkksfkyrkieasiklpktngglwpafwmmgdndkqwpacgeidimemgeqsg
    maagdsekqvntaihygpsaaaheqqyykanvanslqdgnyhtysldwdennltisidnv
    kfhtfdissntyfhdnfyilfnlavggaftgitdinkltglkdgqkvnmyidwvkil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nboB (B:)
    mgsshhhhhhssglvprgshmsdsvgtepeenpqdilfkddfnffdekvwtkethepgwt
    nqelqaydaahvsvgkdgdksvliltaerkgnkiysgrinskgkksfkyrkieasiklpk
    tngglwpafwmmgdndkqwpacgeidimemgeqsgmaagdsekqvntaihygpsaaaheq
    qyykanvanslqdgnyhtysldwdennltisidnvkfhtfdissntyfhdnfyilfnlav
    ggaftgitdinkltglkdgqkvnmyidwvkil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nboB (B:)
    ilfkddfnffdekvwtkethepgwtnqelqaydaahvsvgkdgdksvliltaerkgnkiy
    sgrinskgkksfkyrkieasiklpktngglwpafwmmgdndkqwpacgeidimemgeqsg
    maagdsekqvntaihygpsaaaheqqyykanvanslqdgnyhtysldwdennltisidnv
    kfhtfdissntyfhdnfyilfnlavggaftgitdinkltglkdgqkvnmyidwvkil