PDB entry 5n9o

View 5n9o on RCSB PDB site
Description: EGFP(enhanced green fluorescent protein) mutant - L232H
Class: Calcium binding protein
Keywords: green fluorescent protein, CALCIUM BINDING PROTEIN
Deposited on 2017-02-26, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (2-End)
      • initiating methionine (0)
      • expression tag (1)
      • conflict (64)
      • chromophore (65)
    Domains in SCOPe 2.07: d5n9oa_
  • Heterogens: AE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n9oA (A:)
    mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqla
    dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9oA (A:)
    mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqla
    dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdel