PDB entry 5n92

View 5n92 on RCSB PDB site
Description: Crystal Structure of Human IL-17AF
Class: immune system
Keywords: Cystine-knot, heterodimer, immune system
Deposited on 2017-02-24, released 2017-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-17a
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17A, CTLA8, IL17
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Interleukin-17F
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5n92f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5n92F (F:)
    efrhdsrkipkvghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwny
    tvtwdpnrypsevvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqle
    kvlvtvgctcvtpvihhvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n92F (F:)
    pescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsevvqaqcr
    nlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvtpvihhvq