PDB entry 5n8t

View 5n8t on RCSB PDB site
Description: CRYSTAL STRUCTURE OF STREPTAVIDIN D-amino acid containing peptide Gdlwqheatwkkq
Class: Biotin binding protein
Keywords: STREPTAVIDIN, BIOTIN BINDING, D-AMINO ACIDS, STREPTAVIDIN PEPTIDE COMPLEX, Biotin binding protein
Deposited on 2017-02-24, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n8ta_
  • Heterogens: DLE, DTR, DGN, DHI, DGL, DAL, DTH, DLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n8tA (A:)
    mrkivvaaiavslttvsitasasadpskdskaqvsaaeagitgtwynqlgstfivtagad
    galtgtyesavgnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqy
    vggaearintqwlltsgtteanawkstlvghdtftkvkpsaasidaakkagvnngnplda
    vqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n8tA (A:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk