PDB entry 5n74

View 5n74 on RCSB PDB site
Description: Microtubule end binding protein complex
Class: microtubule binding protein
Keywords: Microtubule end binding protein complex, microtubule binding protein
Deposited on 2017-02-18, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Otolemur garnettii [TaxId:30611]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n74a_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Otolemur garnettii [TaxId:30611]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n74b_
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Otolemur garnettii [TaxId:30611]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n74c_
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Otolemur garnettii [TaxId:30611]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n74d_
  • Chain 'E':
    Compound: Uncharacterized protein
    Species: Otolemur garnettii [TaxId:30611]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n74e_
  • Chain 'F':
    Compound: Uncharacterized protein
    Species: Otolemur garnettii [TaxId:30611]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n74f_
  • Chain 'G':
    Compound: Uncharacterized protein
    Species: Otolemur garnettii [TaxId:30611]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n74g_
  • Chain 'H':
    Compound: Uncharacterized protein
    Species: Otolemur garnettii [TaxId:30611]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n74h_
  • Chain 'I':
    Compound: gly-ser-thr-arg-arg-arg-thr-arg-leu-arg-pro-pro-thr-pro-leu-ser-gln-leu-leu-ser-pro
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N74
  • Chain 'J':
    Compound: gly-ser-thr-arg-arg-arg-thr-arg-leu-arg-pro-pro-thr-pro-leu-ser-gln-leu-leu-ser-pro
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N74
  • Chain 'K':
    Compound: gly-ser-thr-arg-arg-arg-thr-arg-leu-arg-pro-pro-thr-pro-leu-ser-gln-leu-leu-ser-pro
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N74
  • Chain 'L':
    Compound: gly-ser-thr-arg-arg-arg-thr-arg-leu-arg-pro-pro-thr-pro-leu-ser-gln-leu-leu-ser-pro
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N74
  • Chain 'M':
    Compound: gly-ser-thr-arg-arg-arg-thr-arg-leu-arg-pro-pro-thr-pro-leu-ser-gln-leu-leu-ser-pro
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N74
  • Chain 'N':
    Compound: gly-ser-thr-arg-arg-arg-thr-arg-leu-arg-pro-pro-thr-pro-leu-ser-gln-leu-leu-ser-pro
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N74
  • Chain 'O':
    Compound: gly-ser-thr-arg-arg-arg-thr-arg-leu-arg-pro-pro-thr-pro-leu-ser-gln-leu-leu-ser-pro
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N74
  • Chain 'P':
    Compound: gly-ser-thr-arg-arg-arg-thr-arg-leu-arg-pro-pro-thr-pro-leu-ser-gln-leu-leu-ser-pro
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N74
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n74A (A:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n74A (A:)
    aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n74B (B:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n74B (B:)
    aaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5n74C (C:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n74C (C:)
    aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5n74D (D:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n74D (D:)
    aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5n74E (E:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n74E (E:)
    elmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5n74F (F:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n74F (F:)
    lmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5n74G (G:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n74G (G:)
    aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5n74H (H:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n74H (H:)
    aaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.