PDB entry 5n6t

View 5n6t on RCSB PDB site
Description: Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic
Class: hydrolase
Keywords: carba-cyclophellitol, hydrolase, mimic
Deposited on 2017-02-16, released 2017-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: Thermotoga maritima [TaxId:2336]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5n6ta_
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: Thermotoga maritima [TaxId:2336]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08638 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.06: d5n6tb1, d5n6tb2
  • Heterogens: CL, EDO, 8P2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n6tA (A:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n6tA (A:)
    vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
    dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
    gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
    hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
    dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
    dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
    tqkrivkdsgywysnvvknngle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n6tB (B:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n6tB (B:)
    snvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynr
    wkedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiy
    hwdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvh
    apgmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravr
    fmhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlv
    kfdpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvv
    sedgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvd
    ystqkrivkdsgywysnvvknngle