PDB entry 5n6q

View 5n6q on RCSB PDB site
Description: Xenobiotic reductase A (XenA) from Pseudomonas putida in complex with 2-phenylacrylic acid
Class: oxidoreductase
Keywords: Old Yellow Enzyme, Profen, ene-reductase, 2-phenylacrylic acid, oxidoreductase
Deposited on 2017-02-15, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH:flavin oxidoreductase
    Species: Pseudomonas putida [TaxId:303]
    Gene: xenA, HB4184_21910
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n6qa_
  • Chain 'B':
    Compound: NADH:flavin oxidoreductase
    Species: Pseudomonas putida [TaxId:303]
    Gene: xenA, HB4184_21910
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n6qb_
  • Heterogens: 8OZ, CL, GOL, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n6qA (A:)
    msalfepytlkdvtlrnriaippmcqymaedglindwhqvhyasmarggagllvveatav
    apegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhig
    addargwetiapsaiafgahlpnvpramtlddiarvkqdfvdaarrardagfewielhfa
    hgylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgr
    deqtleesielarrfkaggldllsvsvgftipetnipwgpafmgpiaervrreaklpvts
    awgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle
    ryrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n6qA (A:)
    salfepytlkdvtlrnriaippmcqymaedglindwhqvhyasmarggagllvveatava
    pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhida
    rgwetiapsaiafgahlpnvpramtlddiarvkqdfvdaarrardagfewielhfahgyl
    gqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrdeqt
    leesielarrfkaggldllsvsvgftipetnipwgpafmgpiaervrreaklpvtsawgf
    gtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n6qB (B:)
    msalfepytlkdvtlrnriaippmcqymaedglindwhqvhyasmarggagllvveatav
    apegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhig
    addargwetiapsaiafgahlpnvpramtlddiarvkqdfvdaarrardagfewielhfa
    hgylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgr
    deqtleesielarrfkaggldllsvsvgftipetnipwgpafmgpiaervrreaklpvts
    awgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle
    ryrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n6qB (B:)
    salfepytlkdvtlrnriaippmcqymaedglindwhqvhyasmarggagllvveatava
    pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhigd
    argwetiapsaiafgahlpnvpramtlddiarvkqdfvdaarrardagfewielhfahgy
    lgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrdeq
    tleesielarrfkaggldllsvsvgftipetnipwgpafmgpiaervrreaklpvtsawg
    fgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle