PDB entry 5n6f

View 5n6f on RCSB PDB site
Description: Crystal structure of TGT in complex with guanine fragment
Class: transferase
Keywords: TGT, TRNA, GUANINE EXCHANGE ENZYME, TRANSGLYCOSYLASE, transferase
Deposited on 2017-02-15, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720 (0-374)
      • conflict (302)
    Domains in SCOPe 2.07: d5n6fa_
  • Heterogens: ZN, DMS, PEG, GUN, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n6fA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
    ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
    gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
    keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
    mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
    dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
    fsqfaqdfraryfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n6fA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmkqseegvtfkshsrhmlsper
    sieiqhllgsdivmafdetpypatpsraassmersmrwakrsrdafdsrkeqaenaalfg
    iqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylm
    gvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechc
    avcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfrar
    yfar