PDB entry 5n69

View 5n69 on RCSB PDB site
Description: Cardiac muscle myosin S1 fragment in the pre-powerstroke state co-crystallized with the activator Omecamtiv Mecarbil
Class: motor protein
Keywords: myosin, cardiac, Omecamtiv Mecarbil, CK-452, cytokinetics, pre-powerstroke, Motor protein
Deposited on 2017-02-14, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-7
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Myosin-7
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Myosin light chain 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n69g_
  • Chain 'H':
    Compound: Myosin light chain 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n69h_
  • Heterogens: ADP, VO4, MG, 2OW, GOL, TCE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5n69G (G:)
    mapkkpdpkkdeakagakaaaapapapapppapepskepefdpskikieftpeqieefke
    aftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvlgkpkqeelnskmmdfdtflp
    mlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhvlatlgekltedeveklmagq
    edsngcinyeafvkhimag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n69G (G:)
    fdpskikieftpeqieefkeaftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvl
    gkpkqeelnskmmdfdtflpmlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhv
    latlgekltedeveklmaedngcinyeafvkhimag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5n69H (H:)
    mapkkpdpkkdeakagakaaaapapapapppapepskepefdpskikieftpeqieefke
    aftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvlgkpkqeelnskmmdfdtflp
    mlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhvlatlgekltedeveklmagq
    edsngcinyeafvkhimag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n69H (H:)
    pefdpskikieftpeqieefkeaftlfdrtpkcemkitygqcgdvlralgqnptqaevlr
    vlgkpkqeelnskmmdfdtflpmlqhisknkdtgtyedfveglrvfdkegngtvmgaelr
    hvlatlgekltedeveklmagqedsngcinyeafvkhimag