PDB entry 5n66

View 5n66 on RCSB PDB site
Description: Crystal Structure of p38alpha in Complex with Lipid Pocket Ligand 9j
Class: transferase
Keywords: kinase, small molecule, lipid pocket, p38, quinazoline, transferase
Deposited on 2017-02-14, released 2017-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5n66a_
  • Heterogens: BW1, B96, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n66A (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n66A (A:)
    ptfyrqelnktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfvatrwyrapeimlnwmhyn
    qtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqs
    ltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvad
    pydqsfesrdllidewksltydevisfvpppl