PDB entry 5n5j

View 5n5j on RCSB PDB site
Description: Human MMP12 in complex with 3-(5-(1,2-dithiolan-3-yl)pentanamido)propane-1-sulfonate
Class: hydrolase
Keywords: MMP12, lipoic acid, inhibitor, Hydrolase
Deposited on 2017-02-14, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: MMP12, HME
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (0-157)
    • engineered mutation (65)
  Domains in SCOPe 2.07: d5n5ja_
• Heterogens: ZN, CA, HAE, 8NT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5n5jA (A:)
  gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
  gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
  lghssdpkavmfptykyvdintfrlsaddirgiqslyg