PDB entry 5n4f

View 5n4f on RCSB PDB site
Description: Prolyl oligopeptidase B from Galerina marginata - apo protein
Class: hydrolase
Keywords: amanitin biosynthesis, prolyl oligopeptidase, macrocyclase, peptidase, beta-propeller, open form, hydrolase
Deposited on 2017-02-10, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl oligopeptidase
    Species: Galerina marginata [TaxId:109633]
    Gene: POPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n4fa1, d5n4fa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n4fA (A:)
    mssvtwapgnypstrrsdhvdtyqsaskgevpvpdpyqwleestdevdkwttaqadlaqs
    yldqnadiqklaekfrasrnyakfsaptllddghwywfynrglqsqsvlyrskepalpdf
    skgddnvgdvffdpnvlaadgsagmvlckfspdgkffayavshlggdystiyvrstsspl
    sqasvaqgvdgrlsdevkwfkfstiiwtkdskgflyqryparerhegtrsdrnammcyhk
    vgttqeediivyqdnehpewiygadtsedgkylylyqfkdtskknllwvaeldedgvksg
    ihwrkvvneyaadyniitnhgslvyiktnlnapqykvitidlskdepeirdfipeekdak
    laqvncaneeyfvaiykrnvkdeiylyskagvqltrlapdfvgaasianrqkqthffltl
    sgfntpgtiarydftapetqrfsilrttkvneldpddfestqvwyeskdgtkipmfivrh
    kstkfdgtaaaiqygyggfatsadpffspiiltflqtygaifavpsirgggefgeewhkg
    grretkvntfddfiaaaqflvknkyaapgkvaingasnggllvmgsivrapegtfgaavp
    eggvadllkfhkftggqawiseygnpsipeefdyiyplspvhnvrtdkvmpatlitvnig
    dgrvvpmhsfkfiatlqhnvpqnphpllikidkswlghgmgkptdknvkdaadkwgfiar
    alglelktve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n4fA (A:)
    apgnypstrrsdhvdtyqsaskgevpvpdpyqwleestdevdkwttaqadlaqsyldqna
    diqklaekfrasrnyakfsaptllddghwywfynrglqsqsvlyrskepalpdfskgddn
    vgdvffdpnvlaadgsagmvlckfspdgkffayavshlggdystiyvrstssplsqasva
    qgvdgrlsdevkwfkfstiiwtkdskgflyqryparsdrnammcyhkvgttqeediivyq
    dnehpewiygadtsedgkylylyqfkdtskknllwvaeldgvksgihwrkvvneyaadyn
    iitnhgslvyiktnlnapqykvitidlskdepeirdfipeekdaklaqvncaneeyfvai
    ykrnvkdeiylyskagvqltrlapdfvgaasianrqkqthffltlsgfntpgtiarydft
    apetqrfsilrttkvneldpddfestqvwyeskdgtkipmfivrhkstkfdgtaaaiqyg
    yggfatsadpffspiiltflqtygaifavpsirgggefgeewhkggrretkvntfddfia
    aaqflvknkyaapgkvaingasnggllvmgsivrapegtfgaavpeggvadllkfhkftg
    gqawiseygnpsipeefdyiyplspvhnvrtdkvmpatlitvnigdgrvvpmhsfkfiat
    lqhnvpqnphpllikidkswtdknvkdaadkwgfiaralglel