PDB entry 5n30

View 5n30 on RCSB PDB site
Description: Crystal structure of the V72I mutant of the mouse alpha-Dystroglycan N-terminal region
Class: cell adhesion
Keywords: Dystroglycan Cell Adhesion Laminin Binding, cell adhesion
Deposited on 2017-02-08, released 2017-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dystroglycan
    Species: Mus musculus [TaxId:10090]
    Gene: Dag1, Dag-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62165
      • engineered mutation (22)
    Domains in SCOPe 2.08: d5n30a1, d5n30a2
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n30A (A:)
    svlsdfqeavptvvgipdgtavigrsfrvsiptdliassgeiikvsaagkealpswlhwd
    phshileglpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnepqsvraas
    sdpgevvpsacaadepvtvltvildadltkmtpkqridllnrmqsfsevelhnmklvpvv
    nnrlfdmsafmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlg
    ypvvgwhiankkptlpkrlrrqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n30A (A:)
    vptvvgipdgtavigrsfrvsiptdliassgeiikvsaagkealpswlhwdphshilegl
    pldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnepacaadepvtvltvild
    adltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsafmagpgnakkvvenga
    llswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhiankkpt