PDB entry 5n2p

View 5n2p on RCSB PDB site
Description: Sulfolobus solfataricus Tryptophan Synthase A
Class: lyase
Keywords: Tryptophan Synthase, Lyase
Deposited on 2017-02-08, released 2018-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: trpA, SSO0889
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5n2pa_
  • Heterogens: PG4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n2pA (A:)
    gkmlvvymtlgypnvqsfkdfiigavengadilelgippkyakydgpvirksydkvkgld
    iwpliedirkdvgvpiialtyledwvdqlenflnmikdvkldgilfpdllidyiddldki
    dgiiknkglknviftspsvpdllihkvskisdlflyygvrpttgvpipvsvkqlinrvrn
    lvenklivgfglssesdlrdalsagadgiaigtvfieeierngvksainlvkkfrailde
    y